SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015226087.1.10129 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015226087.1.10129
Domain Number 1 Region: 37-140
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.14e-25
Family Pentapeptide repeats 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015226087.1.10129
Sequence length 167
Comment hypothetical protein [Halothece sp. PCC 7418]; AA=GCF_000317635.1; RF=na; TAX=65093; STAX=65093; NAME=Halothece sp. PCC 7418; strain=PCC 7418; AL=Complete Genome; RT=Major
Sequence
MMTKMTQIISLLLACVVLFLPLDAQAQTSTRFQRQSLISADLSGEDLSGETLQLREISDA
NLSAADLSDTDMRGSIFTASVMKDANLHGANFTFTVLNGVDFTNADLSQTILEDAILSRA
TFENTDITGADFTNAVLDSRQIDQLCETASGVNEETGMATRDSLGCL
Download sequence
Identical sequences K9YCM0
gi|428776639|ref|YP_007168426.1| WP_015226087.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]