SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015226350.1.10129 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015226350.1.10129
Domain Number 1 Region: 15-499
Classification Level Classification E-value
Superfamily ADC synthase 9.81e-155
Family ADC synthase 0.000000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015226350.1.10129
Sequence length 503
Comment anthranilate synthase component I [Halothece sp. PCC 7418]; AA=GCF_000317635.1; RF=na; TAX=65093; STAX=65093; NAME=Halothece sp. PCC 7418; strain=PCC 7418; AL=Complete Genome; RT=Major
Sequence
MIEFSQFCELANQGNFIPVYEEWTADLETPVSAWFKVCAGQPYSFLLESVEGGENLGRYS
FLGCDPMWVLENRGESTKQVDRAGKETVYQGNPFTVLKECLASIHPVKLDNLPPGIGGLF
GMWGYELINWIEPRVPVHSRQEEDLPDGVWMQVDQLLVFDQVKRKIFAIAYADLREKQDL
QTAYQEARDRVTTLVSKLQSPLPKIANTVSLSSSPTTDDSTYESTTTQADFEASVEKAKD
YIHAGDIFQVVLSQRLNTAYTGHPFNLYRSLRIVNPSPYMAYYQFGDWQLIGSSPEVMVK
VELTSDHKQQATLRPIAGTRKRGQTPAEDNALAEDLLQDRKELAEHIMLVDLGRNDLGRV
CEKGSVTVDQLMTIERYSHVMHIVSNVIGEVADQQTAWEVLKATFPAGTVSGAPKIRAME
IIAELEPHRRGPYSGVYGYYDFEGQLNSAIAIRTMIVRPESEDKHKVSVQAGAGVVADSI
PQKEYEETLNKAKALLEAIRSLQ
Download sequence
Identical sequences K9YDJ7
WP_015226350.1.10129 gi|428776902|ref|YP_007168689.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]