SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015227521.1.10129 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015227521.1.10129
Domain Number 1 Region: 4-118
Classification Level Classification E-value
Superfamily RbcX-like 4.84e-41
Family RbcX-like 0.0000217
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015227521.1.10129
Sequence length 127
Comment chaperonin family protein RbcX [Halothece sp. PCC 7418]; AA=GCF_000317635.1; RF=na; TAX=65093; STAX=65093; NAME=Halothece sp. PCC 7418; strain=PCC 7418; AL=Complete Genome; RT=Major
Sequence
MNSKRVAQETAQVLQDYLTYQAVRTILDQLSETNPTQAIWLRQFSQQHSLQNSSAFLEAL
MSERKDLVMRIMTVREDLAERVLDFLPEMVRSGIEESNLRYRCQILERLTQTQGEESDDP
DDSHPTE
Download sequence
Identical sequences K9YFK9
WP_015227521.1.10129 gi|428778076|ref|YP_007169863.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]