SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015227897.1.8022 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015227897.1.8022
Domain Number 1 Region: 387-573
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.7e-45
Family Histidine kinase 0.00031
Further Details:      
 
Domain Number 2 Region: 602-731
Classification Level Classification E-value
Superfamily CheY-like 2.85e-35
Family CheY-related 0.00076
Further Details:      
 
Domain Number 3 Region: 315-399
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.84e-24
Family Homodimeric domain of signal transducing histidine kinase 0.001
Further Details:      
 
Domain Number 4 Region: 139-332
Classification Level Classification E-value
Superfamily GAF domain-like 2.4e-18
Family GAF domain 0.0035
Further Details:      
 
Weak hits

Sequence:  WP_015227897.1.8022
Domain Number - Region: 9-65
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000523
Family Flavin-binding PAS domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015227897.1.8022
Sequence length 733
Comment hybrid sensor histidine kinase/response regulator [Dactylococcopsis salina]; AA=GCF_000317615.1; RF=representative genome; TAX=13035; STAX=292566; NAME=Dactylococcopsis salina PCC 8305; strain=PCC 8305; AL=Complete Genome; RT=Major
Sequence
MASESLASDLKQLQEQQALILEQIDRAIAIFDRYDRLITYNQSFLILGGFSPDWLAQQPS
QQEIIEKMATQGKWSKGEQEILIDLIQKADSNPTPCTIEQPSGESLHILITATSDGGYIL
NLRQLTIETDSKEIINRELRRLTFLLGLTERLQPATDIEEIGQFALSYLIETTNAAFGDV
KVISGEGNDRKAELLVNEITSEFIATYGDAIPEMGALMKEGIPYGQGLLWQVVITGKPLF
VDDYANHPQAVEGFRNPGIGQLGIFPIPGHRGDIIGVLTLESRSENPLQSQLQEDIVLAA
CRTLGVAIERAQVQHNLRQANEDLAQASQMKSEFLASMSHELRTPLNSILGFADLLERQR
KETLSENQVKQVKAIKRSGEHLLQLINDILDLSKIEAGKTELDLQPVVVHSLCSQCLRMV
QPRSDKKRIALSLELDYQIERAELDERRVRQILINLLSNAIKFTPEAGKVKLSGYLRYGR
QLLAESRLDRSPVNNSTPYLCLEVSDTGIGIPKEKQGLLFRPFQQLDSSLTRRHEGTGLG
LALTKRLAELHGGTVSVESEENQGSAFRVWLPLTELRTQKEDFSKEETSPEDVLRPFGTE
TTETGNSPRILVVEDQPFNQALICQVLELEGYEVEVIYDGRTMKDLIEAELRSRELLPHL
ILLDIQLPEVDGFELLHQLRETEYWQDVPVIAITAMAMPGDRDRCLDAGADDYIAKPLHL
ETVIEKIKHLISN
Download sequence
Identical sequences K9YPT1
WP_015227897.1.8022 gi|428778455|ref|YP_007170241.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]