SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015228671.1.8022 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015228671.1.8022
Domain Number 1 Region: 10-101
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 5.65e-29
Family Sigma2 domain of RNA polymerase sigma factors 0.0019
Further Details:      
 
Domain Number 2 Region: 106-184
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.00000000000000118
Family Sigma3 domain 0.048
Further Details:      
 
Domain Number 3 Region: 171-254
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.00000000000299
Family Sigma4 domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015228671.1.8022
Sequence length 255
Comment DNA-directed RNA polymerase sigma-70 factor [Dactylococcopsis salina]; AA=GCF_000317615.1; RF=representative genome; TAX=13035; STAX=292566; NAME=Dactylococcopsis salina PCC 8305; strain=PCC 8305; AL=Complete Genome; RT=Major
Sequence
MPSPLTENVKQNSLELLKSYQENPSQVTRNCIVELNLGLVRKEAHHWVHQCGENYEDLIQ
VGCIGLIRAIERFQLSKGNAFSSFAIPYIRGEIQHYLRDRSNTVKIPRRWLELRQQAVKV
TSQLREKLNRQPTDTEIAEALNVSMKEWENVKLAAKNREVLSLDLPLGSGEGDETTSLGE
LVPDAQYRSFQLAQEDQIRLQQGLVGLEDKIRQVLEFVFLHDLTQKEAAEMLGVSVVIVS
RRMKKGLKLLKSKML
Download sequence
Identical sequences K9YTG8
gi|428779231|ref|YP_007171017.1| WP_015228671.1.8022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]