SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015228967.1.8022 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015228967.1.8022
Domain Number 1 Region: 372-628
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 6.68e-63
Family Acylamino-acid-releasing enzyme, C-terminal donain 0.0064
Further Details:      
 
Domain Number 2 Region: 86-119,149-354
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 6.47e-23
Family DPP6 N-terminal domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015228967.1.8022
Sequence length 646
Comment dipeptidyl aminopeptidase/acylaminoacyl peptidase [Dactylococcopsis salina]; AA=GCF_000317615.1; RF=representative genome; TAX=13035; STAX=292566; NAME=Dactylococcopsis salina PCC 8305; strain=PCC 8305; AL=Complete Genome; RT=Major
Sequence
MAQQQITPFGSWKSPITSDLIVSESIGLGGVVYDHQDIYWLEGRPSEGGRYVLVRRTPEG
KVEDVTPKPYKVRTRVHEYGGGAFLVVDKTVYFSNFADQRLYKQSLNHDPEPLTAATNRS
YAELQLDQQRNRAIGICEDSENPVDAEPQNYIAGIDLNTGEITPLVSGCDFYVSPRVSPD
GKQLAWVQWNHPNLPWDDTQLCLGDIDAEGNVTNIQAVTEGKAEAVCHPLWSPDGQLYFV
SDRNNWWNLYRLTSQGEIEPLCEMEAEFGSPHWVFGLSLYDFVSPEKIVCTYTQNGQWYL
GTLDTKTKTLTTLDVSYTDIGSVHSQGENIVFIGGSATQPTSVVKMNLATANSEVLKQAT
DLEIDTGYLSVPEPIAFPTTGNKTAYAWFYPPQNKDYTAPQGELPPLVVKSHGGPTAATS
PRFNLKIQYWTSRGFGFVDVNYGGSTGYGREYRQRLKDNWGIVDVDDCVNVAQYLAQLGK
VDGNRLAITGGSAGGYTTLAALTFRDTFQAGASHYGVSDLEALAQETHKFESRYLDGLVG
QYPRQQELYHARSPIYHTEQLSCPVIFFQGLEDKVVPPNQAEKMVEAIKEKGLPVAYVPF
EGEQHGFRRAENIKRALDGEFYFYSRVFDFTPAEAIEPVEIMNLSY
Download sequence
Identical sequences K9YSP5
WP_015228967.1.8022 gi|428779532|ref|YP_007171318.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]