SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015229231.1.8022 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015229231.1.8022
Domain Number 1 Region: 104-370
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.13e-49
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015229231.1.8022
Sequence length 472
Comment glycosyl transferase [Dactylococcopsis salina]; AA=GCF_000317615.1; RF=representative genome; TAX=13035; STAX=292566; NAME=Dactylococcopsis salina PCC 8305; strain=PCC 8305; AL=Complete Genome; RT=Major
Sequence
MPQNSWTDNNSYEELSSSIEALLWSDVETEDEEEWSSDFFQGLGGRRWKAAVTLMMIWGT
TIALHLISWGSWLVLAVTAVFTLQVTRLLCSRPVASPPALAESDQESIPTVSILVAAKNE
ETVITDLVENLCHLDYPQDKYEIWLIDDHSTDRTPILLDQFAQKYRQLNVLHRSANATGG
KSGALNQALTLSKGEIVAVFDADAQIPSDILRQVVPFFHQESMGAVQVRKSIANADLNFW
TKGQQAEMALDSYFQEHRIGLGGIGELRGNGQFVRRRALASCGKWNEQTITDDLDLTMRL
HLDGWDIGFVSHPTVQEEGVTSAIALWHQRNRWAEGGYQRYLDYWRWIIRNPMGIGKTFD
LITFLLFQYILPTAAIPDLLMVLLRQEAPLYFPATSIMFSFSIWGMFRGLQNTQNPKTPQ
NWGEIFGETLRGTIYMIHWLLIIPSMTARLAVRPKKLKWVKTSHQGEQSCET
Download sequence
Identical sequences K9YVX1
WP_015229231.1.8022 gi|428779804|ref|YP_007171590.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]