SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015229474.1.8022 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015229474.1.8022
Domain Number 1 Region: 61-212
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 3.61e-53
Family Sigma2 domain of RNA polymerase sigma factors 0.0000693
Further Details:      
 
Domain Number 2 Region: 273-368
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 3.55e-24
Family Sigma4 domain 0.0014
Further Details:      
 
Domain Number 3 Region: 215-288
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 3.4e-17
Family Sigma3 domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015229474.1.8022
Sequence length 375
Comment RNA polymerase sigma factor, RpoD/SigA family [Dactylococcopsis salina]; AA=GCF_000317615.1; RF=representative genome; TAX=13035; STAX=292566; NAME=Dactylococcopsis salina PCC 8305; strain=PCC 8305; AL=Complete Genome; RT=Major
Sequence
MTDIKLMTSQNTKPEESLTPIEGIETIIAPLEETDASEGQLVEVDFSQEDDGDVNPYQGS
KSDDTVGAFFKEMARYPLLQPDEEIELAQKVKFLADMENKRQELAIESGSSPTKEELAAT
VSLSVKELERKLHQGRLAKRQMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAIGLNRATE
KFDPNKGYKFSTYAYWWIRQAITRTIANDARTIRLPIHIVEKLNKLKKVQRDLKQELQRN
PTEEELAAGLDISQSQLHQLLQLRRQSLSLNHRVGKGEDTELLELLEDHEMRLPEDQMNE
TMMNQELSDVLGDVLNEREKDVISLRYGLNTSHPYTLEEVGYFLNLSRERVRQIQSKAMR
KLRRPQVARRLKGWL
Download sequence
Identical sequences K9YVD0
WP_015229474.1.8022 gi|428780048|ref|YP_007171834.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]