SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015249492.1.65975 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015249492.1.65975
Domain Number 1 Region: 254-408
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.00000000000000165
Family AmyC N-terminal domain-like 0.05
Further Details:      
 
Domain Number 2 Region: 564-972
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00000377
Family alpha-mannosidase, C-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015249492.1.65975
Sequence length 973
Comment glycosyl hydrolase family 38 [Singulisphaera acidiphila]; AA=GCF_000255675.1; RF=na; TAX=886293; STAX=466153; NAME=Singulisphaera acidiphila DSM 18658; strain=DSM 18658; AL=Scaffold; RT=Major
Sequence
MSMPSPESAEPQTEAPSPPVPEGGHWSLIALVSHDGVEPPANLSESEALGIWCARSVLWH
PALLAQTQMLPRIESIDAPTSPGPRELRVVAAGVLDRLPSGYQTQAEDAGAIVVEGGADR
LALVRDLLARINAVAPALDTENEGLITAANDFLALGTARWMLRDLTIAMGHADALDTESL
EREVLAGALAWCQGDHPAATNRLRAAFELLTQARERFYPVDAYIVDVCLLDPSTPPGSLT
DALKARAPVTFLAPALAVEKLAESDPEAIASVREAITEGWADVVGGSYTESEEPLLPMES
VLWQFRRGAEVYRRHLDDRNVETLARRRFSLYPELPQLAKRFGFRFAVHLGFDAGRFPIR
PEAKRLWEGPDGTSLETLTRPPLGADRSAQGMFIPWRLATSMKDDHVATLPFVHWPNPVA
PWYLDLRRVSAFSPVLARWVTLNDYFHLTDRPYETFRPEHDQYVTPYLAQAVARRDERPI
SRKAVHARLRARLEALNATRALERAVLGTAPDPQTRAEEVSTLDLETSLETGQVDEVHSA
LERAIPDAASRLAVAIQGETSEARPGFFVFNPLGVARRAAVLLPDAALDLRPEGPLRAAQ
FTDEGVWAVVDLPAFGYAWVPRDADLAATPTTPGVLSVRGRLLGNESMAVEIDPTSGGIR
SIRTPTEEVARLGQQLVVSGLVASDGSPVSTKMREESFEVEYGGPALVQAISRGVIVDPR
DDRRLASFTQRYRLWTGRPILELDVTLNDLDPDWLARSAQADPWAHNLACRWAWPDPNSM
LRRTCFFSPEVTEADRPETPDALDISTRRQRTALLFGSLAHHRRHGQRMLDTLLIAGRET
ERNFRLGVVLDLEHPFHASMDFIAPAPVVPTESGPPRTGPTGWLFQLDNKAVAATRLEPL
ENTGDNHGWGVVFHLFETAGRPARCRLRLFRNPVWARQTDFHHELVVDLPIEEDSILIDL
TPHEMARIEVTLG
Download sequence
Identical sequences L0DNJ6
WP_015249492.1.65975 WP_015249492.1.91224 gi|430746974|ref|YP_007206103.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]