SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015259793.1.12263 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015259793.1.12263
Domain Number 1 Region: 5-93
Classification Level Classification E-value
Superfamily YccV-like 1.44e-33
Family YccV-like 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015259793.1.12263
Sequence length 106
Comment hemimethylated DNA-binding protein [Thioalkalivibrio nitratireducens]; AA=GCF_000321415.2; RF=representative genome; TAX=1255043; STAX=186931; NAME=Thioalkalivibrio nitratireducens DSM 14787; strain=DSM 14787; AL=Complete Genome; RT=Major
Sequence
MTAATRFSVGELVHHRKFGYRGVIVGVDPVFAGSDEWYEAVARSRPPRDQPWYHVLVDGD
THSTYVAERHLEADTSGVQIEHPDLGRYFDRFVNGRYGRGTGSRIH
Download sequence
Identical sequences L0E0E7
gi|430762309|ref|YP_007218166.1| WP_015259793.1.12263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]