SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015271270.1.71677 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015271270.1.71677
Domain Number 1 Region: 1-255
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.06e-70
Family Phosphate binding protein-like 0.0000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015271270.1.71677
Sequence length 261
Comment ABC transporter substrate-binding protein [Pseudomonas putida]; AA=GCF_000325725.1; RF=na; TAX=1215088; STAX=303; NAME=Pseudomonas putida HB3267; strain=PC9; AL=Complete Genome; RT=Major
Sequence
MKKLALLGALALSVFSLVSQADEKPLKIGIEAAYPPFAFKQPDGSIAGFDYDIGNALCEE
MKTKCTWVEQEFDGLIPALKVRKIDAILSSMSITEDRKKSVDFTKRYYLTPARLVMKEGT
AVSDSLDELKGKKIGVQRGSIHDRFAKEVLGAKGATVVPYGTQNEIYLDVAAGRLDGTVA
DATLLEDGFLKTGAGKGFAFVGPSFTDAKYFGDGIGIAVRKGDKANVDRINAAIDAIRAN
GKYKEIEKKYFNFDIYGPDSK
Download sequence
Identical sequences A0A136QF53 L0FPX4
WP_015271270.1.71677 gi|431803740|ref|YP_007230643.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]