SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015271508.1.28354 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015271508.1.28354
Domain Number 1 Region: 4-88
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.99e-27
Family Glutathione S-transferase (GST), N-terminal domain 0.00067
Further Details:      
 
Domain Number 2 Region: 75-197
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 8.87e-26
Family Glutathione S-transferase (GST), C-terminal domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015271508.1.28354
Sequence length 209
Comment MULTISPECIES: glutathione S-transferase [Pseudomonas putida group]; AA=GCF_000510325.1; RF=na; TAX=1435058; STAX=76759; NAME=Pseudomonas monteilii SB3101; strain=SB3101; AL=Complete Genome; RT=Major
Sequence
MSNPIKLYNFPKSGHAHRIELMLSLLNLPTELVFVDLAKGAHKQPDFLALNPFGQVPVID
DNGTVIADSNAILVYLAKKYDNGTWLPEEPAAAARVQRWLSVAAGPLAFGPAAARLVTVF
GASFNTDEVITRAHTLLKVIDAELAKTPFLAGSTPTIADIANYSYIAHAPEGNVSLEPYA
NVRSWLARIEALPRFVPMPRTVIGLQTSA
Download sequence
Identical sequences A0A059V507 A0A099N586 L0FP07 V7D4L0 V9V4B9
gi|568183617|ref|YP_008956297.1| WP_015271508.1.23948 WP_015271508.1.28354 WP_015271508.1.35335 WP_015271508.1.57632 WP_015271508.1.65739 WP_015271508.1.71677 WP_015271508.1.7288 WP_015271508.1.80759 WP_015271508.1.95946 gi|431804037|ref|YP_007230940.1| 2035946184 gi|568188990|ref|YP_008961660.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]