SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015271555.1.80759 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015271555.1.80759
Domain Number 1 Region: 4-140,175-386
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 5.63e-97
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000000213
Further Details:      
 
Domain Number 2 Region: 389-547
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 8.72e-39
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00000563
Further Details:      
 
Domain Number 3 Region: 573-678
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.15e-29
Family Myf domain 0.00032
Further Details:      
 
Domain Number 4 Region: 141-175
Classification Level Classification E-value
Superfamily Methionyl-tRNA synthetase (MetRS), Zn-domain 0.00000000000275
Family Methionyl-tRNA synthetase (MetRS), Zn-domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015271555.1.80759
Sequence length 679
Comment MULTISPECIES: methionine--tRNA ligase [Pseudomonas]; AA=GCF_000831585.1; RF=na; TAX=70775; STAX=70775; NAME=Pseudomonas plecoglossicida; strain=NyZ12; AL=Complete Genome; RT=Major
Sequence
MSEPRQILVTSALPYANGSIHLGHMLEYIQTDMWVRFQKLRGNQCIYVCADDAHGSAIML
RAEKEGITPEQLIANVQAEHSSDFADFLVDFDNFHSTHSEENRELSGLIYARLRDAGHIA
TRSVTQYFDPEKGMFLADRFIKGTCPKCAAEDQYGDNCEKCGATYAPTELKNPKSAISGA
TPVLRDSQHFFFKLPDFQAMLQQWTRSGTLQDAVANKLAEWLDSGLQEWDISRDAPYFGF
EIPGEPGKYFYVWLDAPIGYMASFKNLCARRPELDFDAFWNEGSKAELYHFIGKDIVNFH
ALFWPAMLEGAGFRKPSAVNVHGYLTVNGAKMSKSRGTFIKARTYLDHLQPEYLRYYYAA
KLGRGVDDLDLNLEDFVQKVNSDLVGKVVNIASRCAGFIHKGNEGVMVAGDAAPELTEAF
LAAAPSIADAYEGRDFGRAMREIMALADRANAWIADKAPWSLAKQEGKQDEVQAICAQGI
NLFRQLVIFLKPVLPVLAADAEAFLNVAPLTWNDHLSRLENHQLNPFKALMSRIEPAKVE
AMVAASKEDLLAAEAKAPAGNGELAKDPLSAEIEFDTFAAVDLRVALIVKAEAVPGADKL
LQLTLDIGDERRNVFSGIKSAYPDPSQLEGRLTMMVANLKPRKMRFGVSEGMVMAAGPGG
EEIYLLSPDSGAKPGQRIK
Download sequence
Identical sequences A0A059V528 A0A099N4V7 A0A136QDB3 L0FPY0 V7DE30 V9V6W3 V9X1Z4
gi|568183680|ref|YP_008956367.1| WP_015271555.1.1643 WP_015271555.1.23948 WP_015271555.1.28354 WP_015271555.1.35335 WP_015271555.1.65739 WP_015271555.1.71677 WP_015271555.1.7288 WP_015271555.1.76210 WP_015271555.1.80759 WP_015271555.1.95946 2035931670 gi|568189053|ref|YP_008961730.1| gi|431804098|ref|YP_007231001.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]