SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015324079.1.68990 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015324079.1.68990
Domain Number 1 Region: 2-101
Classification Level Classification E-value
Superfamily GlnB-like 1.07e-32
Family Divalent ion tolerance proteins CutA (CutA1) 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015324079.1.68990
Sequence length 103
Comment divalent-cation tolerance protein CutA [Methanomethylovorans hollandica]; AA=GCF_000328665.1; RF=representative genome; TAX=867904; STAX=101192; NAME=Methanomethylovorans hollandica DSM 15978; strain=DSM 15978; AL=Complete Genome; RT=Major
Sequence
MIIVVHTTTANMDEAKSIANALVEKGFAACVSMHPVTSVYKWKGNIEEEGEIELSIKTTS
EMLESVKKAIIYMHSYELPALIWWPVDGDEKYTEWIVDCVKPE
Download sequence
Identical sequences L0KUW4
WP_015324079.1.68990 gi|435850855|ref|YP_007312441.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]