SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015331750.1.89626 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015331750.1.89626
Domain Number 1 Region: 123-275
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.18e-43
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00035
Further Details:      
 
Domain Number 2 Region: 393-557
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 8.37e-30
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0014
Further Details:      
 
Domain Number 3 Region: 22-122
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 7.03e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.007
Further Details:      
 
Domain Number 4 Region: 254-278,306-407
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.96e-23
Family Duplicated SiR/NiR-like domains 1 and 3 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015331750.1.89626
Sequence length 711
Comment sulfite reductase [Fibrella aestuarina]; AA=GCF_000331105.1; RF=representative genome; TAX=1166018; STAX=651143; NAME=Fibrella aestuarina BUZ 2; strain=BUZ 2; AL=Chromosome; RT=Major
Sequence
MSIAFSPTVSNAAQRDILDLQKKVEAFRSGQMTDEQFRKFRLARGVYGQRQAGVQMIRIK
LPYGRITADQLIRIADVSDRYATGNLHATTRQDIQLHFVKLADSPQLWADLEDAGITLKE
ACGNTVRNVTGSARAGIDPDEPFDVSAYAHAIFEYFLRNPICQEMGRKFKISVSSSEKDS
AYGYMHDIGLIPRVQNGQRGFKVLLAGGLGAQPFLAQTATEFIEEERVIPFIEAVIRVFD
RYGERTKRHKARMKYLLNDLGLETFLEKVQEEWTALRSKELPVSSLAFDVREARPEAAGY
VLQTQDSKLKNWFATNVFEQKQAGWYAVQLRVLLGDMSSDTARALAQIVKQYAADDIRVT
VNQGYLLRYIRPEDLEAVFHALDALGLAEPGFDTTADITTCPGTDTCNLAISSSYGITRA
LEEMMKAEFPDIIFNNDIKIKISGCMNGCGQHSVANIGFHGSSMKNGAYVLPALQVLLGG
GFNGAGVGQLGDKVVKIPTKRGPDALRLLFQDYETNALDGEYYNDYYGRKGKNYFYTLLK
PLADLKTVQDSDYVDWDHTEPFVTEVGVGECAGVMIDLVATTLDEAGEKLVWADEALAES
RWADAIYHAYNVLITGAKAALMTRDVNTNTHHGIVTDFDREFAAYDGFHEAEGQFKALAY
SINKNEPSAQFAQSFVPKAAAFLKSVQAYRAEQIARDGQPELQELTQAQDS
Download sequence
Identical sequences I0K948
WP_015331750.1.89626 gi|436836028|ref|YP_007321244.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]