SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015334460.1.89626 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015334460.1.89626
Domain Number 1 Region: 2-134
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 9.02e-48
Family Molybdopterin synthase subunit MoaE 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015334460.1.89626
Sequence length 136
Comment molybdopterin-converting factor subunit 2 molybdopterin synthase subunit 2 [Fibrella aestuarina]; AA=GCF_000331105.1; RF=representative genome; TAX=1166018; STAX=651143; NAME=Fibrella aestuarina BUZ 2; strain=BUZ 2; AL=Chromosome; RT=Major
Sequence
MIALTADPIDFSSAYHYLQTDEAGAIDFFFGVVRNNTQKRDVQQLDYEAYGPMAVREMQK
IADEACRRWNVLRYVIIHRTGVLRIGEMAVLIGVATPHRDAAFEATRYIIDTIKQTVPIW
KKERFTDGEVWVNATP
Download sequence
Identical sequences I0KGW0
gi|436838740|ref|YP_007323956.1| WP_015334460.1.89626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]