SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015408389.1.26724 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015408389.1.26724
Domain Number 1 Region: 19-324
Classification Level Classification E-value
Superfamily SAICAR synthase-like 9.81e-47
Family SAICAR synthase 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015408389.1.26724
Sequence length 340
Comment phosphoribosylaminoimidazolesuccinocarboxamide synthase [Natronomonas moolapensis]; AA=GCF_000591055.1; RF=representative genome; TAX=268739; STAX=416273; NAME=Natronomonas moolapensis 8.8.11; strain=8.8.11; AL=Complete Genome; RT=Major
Sequence
MTSVKGFRIEEAATADSLGTGAFVFTDDYSVFDWGKMPDAIPNKGASLCAMGAANFERLE
AEGIATHYRGVVSGGGAVTGLDSVATPPREMAIELTRVPDLPHEGREYDYTAYHDAAGEN
YLIPLEIVFRNTVPVGSSLRSRADPGDFGLEYDAWPDGPVDLPEPVVEFSTKYEESDRYL
SRENADYVAGAADVDALESIARDVNRIITETAAAAGLKHEDGKIECLYYDGEIRVADVVG
TFDENRFSYAGQQLSKEVLRQYHKRTQPEWVEAVAEAKSEAKAEDVADWRELCGVDPEPL
PAHVVDAAREMYTAGTNAYLGRDLFDAPALEDAVAAIESF
Download sequence
Identical sequences M1XNN8
WP_015408389.1.26724 gi|452206188|ref|YP_007486310.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]