SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015419467.1.87448 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015419467.1.87448
Domain Number 1 Region: 190-382
Classification Level Classification E-value
Superfamily PheT/TilS domain 7.06e-66
Family B3/B4 domain of PheRS, PheT 0.000022
Further Details:      
 
Domain Number 2 Region: 38-182
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.86e-27
Family Myf domain 0.0066
Further Details:      
 
Domain Number 3 Region: 657-753
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.19e-24
Family Anticodon-binding domain of PheRS 0.00098
Further Details:      
 
Domain Number 4 Region: 456-640
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.95e-22
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00072
Further Details:      
 
Domain Number 5 Region: 395-463
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000119
Family Domains B1 and B5 of PheRS-beta, PheT 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015419467.1.87448
Sequence length 755
Comment MULTISPECIES: phenylalanine--tRNA ligase subunit beta [Hydrogenobaculum]; AA=GCF_000348765.2; RF=na; TAX=547146; STAX=547146; NAME=Hydrogenobaculum sp. SN; strain=SN; AL=Complete Genome; RT=Major
Sequence
MFAPLSILSEYVEIEDPQYVADKLSISGTETTLKRFGTDIKNVKVGEILSIQKLENLNLC
KVFLGDTAIDVITSASNVYVGAKVPVAVKGASLGSKTIDTKTFKGFESQGMLLSASELGL
DDIEEGILILDNNVEVGKDVASLLDFGEYVLECEITPNRGDLLSIVGIAREISAITNKPF
NLNIEKDLPEKIDIDISIDTKGCYRYVGSVVEDVSVKSSTLLLKKTLWKMGLKTISNVVD
ITNYVMMMLGQPLHAFDKDKIGSKIVIRQAKQKEKLIALDKKEYELDESIMVIANDKGPI
ALAGVIGGLDSSISHDTKNILLESALFDPIFVRKASKTLKLSTDASYRFERGIDIDMALK
ASFFALKLIEKEAGGKVIGYNEVIREALPVKRFFLPMNDYIRYTAINFEKEKISEIANKL
GIPNKPMRCGIEFEAPSHRYYDIDSSIDLIEEIVRITDFNTFETDPLTLLPKPNDKKDYT
YEIKNKLVANGLKEVINLSFDKIEDYEALGLEKPTIEIKNPILPSFRFLRRYLTPSMIRL
ADQNVKKHIYDFAIFEISDIFKEDSQSTHICILLRGHKRIYPKTKWNINHIKEIIKAINK
DVMFGFSNLSFLHPYQQGSLKFDDKDIGFFGVLKSDILQDTIICEFEIPNKAKYREIKEI
SKYPPIVRDISLIMSIDFDVQKLIILIREFFGSMLENVLVFDFYKGEQIEEDKKSVGLRL
SLRALDRSLEDEEVNVLIEKLLERLKEEGIELRFA
Download sequence
Identical sequences M1QIY9
gi|452944066|ref|YP_007500231.1| WP_015419467.1.67077 WP_015419467.1.67908 WP_015419467.1.87448 WP_015419467.1.9515 gi|471264432|ref|YP_007647286.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]