SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015420511.1.101204 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015420511.1.101204
Domain Number 1 Region: 423-565
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.27e-39
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00058
Further Details:      
 
Domain Number 2 Region: 120-278
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.93e-39
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00052
Further Details:      
 
Domain Number 3 Region: 1-126
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.45e-34
Family Duplicated SiR/NiR-like domains 1 and 3 0.026
Further Details:      
 
Domain Number 4 Region: 255-279,329-436
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.32e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015420511.1.101204
Sequence length 575
Comment nitrate/sulfite reductase [beta proteobacterium CB]; AA=GCF_000342265.1; RF=na; TAX=543913; STAX=543913; NAME=beta proteobacterium CB; strain=CB; AL=Complete Genome; RT=Major
Sequence
MYKYDHIDQTLVDQRVTQFRDQVERRLNGTLAEEEFRPLRLQNGLYHQRHAYMLRVAIPY
GLLSAKQLRTLAFIADKYDRGYGHFTTRQNIQFNWVELEQTPDILAELAKVEMHAIQTSG
NCIRNITSDAFAGVAADEYIDPRPICELLRQWSTLHPEFAHLPRKFKFAINGAKEDRTVL
LCHDVGVELKKNPEINNGELTADIYAGGGMGRTPILGSLIKQGLPWQVLPSYLTALLRVY
NRFGRRDNLYKARIKILVKALGPEEFARQVEGEWAQLHNDTKQSKDNFTQAEWERVAKHF
TKPNYKTLPALSNAQLQSHVESKLDANEKIAFTRWLERNVKPHQVPGYVSVILSLKPHGT
AAPGDATSAQMNAIADLADHYSFGELRVTHEQNLVLADVEQAELLNLWRAAKNYNLVLPN
IGLLTDIIACPGGDFCSLANAKSLPIAKAIQERFDDLDYLHDLGDITLNISGCINSCGHH
HVGNIGVLGVDKDGEEWYQITLGGEQGNDASIGKVIGPSFYANEIPDVMTSLINTYVEQR
TGDEPFIETYRRLGVTPFKEAAYKNNGKHSKEALT
Download sequence
Identical sequences M1SES1
WP_015420511.1.101204 gi|456062669|ref|YP_007501639.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]