SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015440873.1.75388 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015440873.1.75388
Domain Number 1 Region: 434-752
Classification Level Classification E-value
Superfamily Radical SAM enzymes 8.89e-43
Family MoCo biosynthesis proteins 0.036
Further Details:      
 
Domain Number 2 Region: 16-329
Classification Level Classification E-value
Superfamily Radical SAM enzymes 1.7e-35
Family Biotin synthase 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015440873.1.75388
Sequence length 791
Comment FO synthase [Ilumatobacter coccineus]; AA=GCF_000348785.1; RF=representative genome; TAX=1313172; STAX=467094; NAME=Ilumatobacter coccineus YM16-304; strain=YM16-304; AL=Complete Genome; RT=Major
Sequence
MTTDHTPDHPLLGESLADLMALATARRDETFGTRITYSPKVFIPLTFLCNDSCGYCTFAQ
PPARVEKPYLDPEDVLKIAKQGARNGCHEALFTLGERPEDRYEVAREWLRERGYDSTVHY
VAAMAELVLRETGLLPHANAGALSLDELAQLRPVSPSQGMMIESIAPDLEAHRGAPDKVP
ARRLATLDAAGELQIPFTTGILIGIGDTRADQLAGLEAIAASHQQHGHVQEVIVQNFLPK
LRTAMKGVRACPSDDYLWILAAARLILPPEVHLQAPPNLSDDFGALLDAGIDDWGGVSPV
TADHVNPERPWPDLDRLREVTEARGHTLAPRLTVYPEFVRDRERWLDPALHFPVIDRADS
EWLGRDDPGQIWPEKTTAADTVADGAEFVLVGHRSTTWYSGADSAPPTLVPAEPKPIRGA
VAEVLDGIADGQEPDVDQIETLFHARGPEVVAVAAAADEMRRELVGDTLTWVNNRNINYT
NVCTFKCKFCGFSKGPLSLNLRGTPYLLTLDDIAQRAKEGWDLGATEVTLQGGIHPDFDG
DYYIDVTRAVKDAVPDMHVHGFTALEVTEGAKRLGEDLQTYLLRLKEAGLASLPGTAAEI
LDDEVRAILCPDKVNTEEWLEAHRAAHAVGLHSNVTMMYGAVEEPIHWARHLVKTRDLQK
ENVKLGQVGFTEFVGLPFVHMASPIYLQRRARRGPTFRENLMIHSIARLAYGELIPNIQA
SWVKVGLVGTSQMINAGCNDLGGTLMDENISRAAGASHGQSMTIQSFHDFAESVGRPIEQ
RTTSYGRVEAV
Download sequence
Identical sequences M4ZZS9
gi|470177520|ref|YP_007563564.1| WP_015440873.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]