SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015441190.1.75388 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015441190.1.75388
Domain Number 1 Region: 83-342,378-424,464-493
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.6e-38
Family Pectin methylesterase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015441190.1.75388
Sequence length 512
Comment hypothetical protein [Ilumatobacter coccineus]; AA=GCF_000348785.1; RF=representative genome; TAX=1313172; STAX=467094; NAME=Ilumatobacter coccineus YM16-304; strain=YM16-304; AL=Complete Genome; RT=Major
Sequence
MQTRARGFKAVTLAIGAAMLVAACGGSDGSANLADEPEAVGTAAPEPTDPPATDAPEPEP
TDPPATDAPEPEPTDPPATDAPGPGDDGVLDVPAEFTTITEAVDAAQPGDLVLIAPGTYN
EAVNVVTDEIVIRGLEREGVVLDGQFELDNGIRVLGARGVAVENLTVQNYTDNGVFFTGV
DGYRASYVTAYRNGDYGIYAFDSVTGQIEHSYGAGSPDAGFYIGQCYPCDAVVDNVISEH
NGLGYSGTNAGGNLIIANSRFNNNRAGIVPNSGSYELCYPQRQNLIVGNTVYSNNQPDTP
AIDVAILAMGNGILIPGGVGNTVERNLVYDHDRTGIGLVPFLEEGANDDIPEQSEWDTPC
SEQRLEPPATEIPESLLWDSFDNVISDNVVSDSREADLAVEGVGQPTGELRNCWSGNTFA
TSAPAALETIAPCGTDAAAPDDAVWETEALNVLRWLGEVDSRPEPVDYETAPLPPLPDLD
DMPDAATAPAQPATDVPFAIDTDAITTPVADG
Download sequence
Identical sequences M4ZZ88
gi|470177837|ref|YP_007563881.1| WP_015441190.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]