SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015441247.1.75388 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015441247.1.75388
Domain Number 1 Region: 5-245
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 7.85e-80
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0000418
Further Details:      
 
Domain Number 2 Region: 231-382
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 3.38e-45
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015441247.1.75388
Sequence length 383
Comment acyl-CoA dehydrogenase [Ilumatobacter coccineus]; AA=GCF_000348785.1; RF=representative genome; TAX=1313172; STAX=467094; NAME=Ilumatobacter coccineus YM16-304; strain=YM16-304; AL=Complete Genome; RT=Major
Sequence
MEMTIYDDEHELFRDSFRGFVQTHMSPHVERWERDGIMDRDVYLEAGKLGFLGMAIPERF
GGGGIKDFRFNAVLNEEIARAGIGGGGLGMMLHNDITTPYFIEYCTDEQAQRWLPGIASG
ELITAIAMTEPGTGSDLQSIATTAVRDGDEYVINGAKTFITNGINSDLVIVACKTGDPKD
GANAMSLIVVERGMAGFERGRNLDKIGQHSADTAEMFFSDVRVPVTNVLGEEGKGFQYLS
FNLAQERLSIGLYGLAAATAVLDWTVEYVKERTAFGKPLSSFQNTKFVLAEVATEIEVTK
PFIDQCVMKLNAGELSPGVAAQSKLWGSEMQNRCIDKCLQLFGGYGYTTEYPVGRAFADA
RVCTIYGGTSEIMKTIISKDVLA
Download sequence
Identical sequences M5AKX1
WP_015441247.1.75388 gi|470177894|ref|YP_007563938.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]