SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015441425.1.75388 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015441425.1.75388
Domain Number 1 Region: 1-58
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 2.32e-19
Family Ribosomal protein L32p 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015441425.1.75388
Sequence length 60
Comment 50S ribosomal protein L32 [Ilumatobacter coccineus]; AA=GCF_000348785.1; RF=representative genome; TAX=1313172; STAX=467094; NAME=Ilumatobacter coccineus YM16-304; strain=YM16-304; AL=Complete Genome; RT=Major
Sequence
MAVPKKKTSKSKTRSRRASAWKLNAPARSICPRCSSAKVPHTVCSSCGWYRDRYVVDVKS
Download sequence
Identical sequences M5A001
WP_015441425.1.75388 gi|470178072|ref|YP_007564116.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]