SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015482948.1.3747 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015482948.1.3747
Domain Number 1 Region: 112-286
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.000000000456
Family Phosphate binding protein-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015482948.1.3747
Sequence length 319
Comment hypothetical protein [Bacillus subtilis]; AA=GCF_000349795.1; RF=na; TAX=1302650; STAX=1423; NAME=Bacillus subtilis subsp. subtilis str. BAB-1; strain=BAB-1; AL=Complete Genome; RT=Major
Sequence
MKKSIILLIFLLIFMQGDIRQAAAPRLPDGPIEIVVPAEPSGGWDVTAQAIQSVLRQKQI
VKGDVHIVYKPGGGGEKGWKYVNKSSKQTISMTSSLILSNDLLGQSKLKMADFTPLAILS
KEWQTVALPKGSALTNGKDVLNEINMHPGKVRIGFAPGFGNDDQLSFVRAADMYGIDAFD
IQFSQYDSSEQLIQALIRHEIEAASMTLSEAKPYERNGDITLAAVTSDKRLPGFPNVPTW
KEQGIPFVFSHWRGILGPKNMSEEEISYWDQALKEVTSSPEWKRKINEQDWESFYLNSRE
TKRFLEEQSAFYQSIMTGN
Download sequence
Identical sequences gi|472329256|ref|YP_007661532.1| WP_015482948.1.3747 WP_015482948.1.54949 WP_015482948.1.91133 WP_015482948.1.99091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]