SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015489342.1.98982 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015489342.1.98982
Domain Number 1 Region: 54-169
Classification Level Classification E-value
Superfamily E set domains 1.19e-17
Family Copper resistance protein C (CopC, PcoC) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015489342.1.98982
Sequence length 278
Comment copper resistance protein [Clavibacter michiganensis]; AA=GCF_001643055.1; RF=na; TAX=31963; STAX=28447; NAME=Clavibacter michiganensis subsp. nebraskensis; strain=DOAB 395; AL=Contig; RT=Major
Sequence
MTPGGRIPARGGAGRRPLRTLAAAVAGAALATGAFALAGLAQGSGPDGALSASAHDYLVS
SSPAAGSTIDAPPSEVTLTFNDVILDLGTPGGAGGDASTGSGTGAGGSSIVQVTGPDAQG
MHFETGCATNSGRTVSVPVALGGSGQYTVTWRVVSADGHPVSDSIAFMYQAPAGVTASSG
TADGPGCAAAQEGAAGSGAAASGGSGGAGSSTDAGTAAGQEQGVTPYLGVIVGVSIGIVV
LAAAAVVLIVVTGRRKPAASAAAPVMGDAPPEGGPPAA
Download sequence
Identical sequences M5B6R7
gi|473832594|ref|YP_007684892.1| WP_015489342.1.38469 WP_015489342.1.57954 WP_015489342.1.98982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]