SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015490080.1.38469 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_015490080.1.38469
Domain Number - Region: 126-214
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00732
Family Apolipoprotein 0.013
Further Details:      
 
Domain Number - Region: 38-162
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0222
Family Apolipoprotein A-I 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015490080.1.38469
Sequence length 594
Comment hypothetical protein [Clavibacter michiganensis]; AA=GCF_000355695.1; RF=na; TAX=1097677; STAX=28447; NAME=Clavibacter michiganensis subsp. nebraskensis NCPPB 2581; strain=type strain: NCPPB 2581; AL=Complete Genome; RT=Major
Sequence
MPHDDTPFSPAMRGYNRDEVDRAVADLRRELIRSNQQGAELRAEAERLRRSEQELRDELD
EVGSPTFAGLGSRLEATLRVAEEQSTRLVAQADADAGRLRRATQEETDAQRAEAEATARH
LVDSARAQAAQILDAARREADDLHERADDRAEGLRSDAEREAAALLLRTRTEVADLRATA
ERDTDAQRAEAAREVAELRARVDRETDEARRDAADLARDTVLARGALERELADARARHDE
IVAEERAELDRDVRETEERLRLDEETRRIALAQLDEQTRADLDREIEQARTDWDRDLQAS
RDDFDRRILAERTAFDRDVEETRAALEREIAETREALELELATARGDLARDEDEARTDLA
RDIAQGTERLERETRATRAQLELEAVTARAALEREIAEAEALEADRREAERLRLEREVAE
TRREIAAEADEARLLLSREIEQGHLDLDAEITARRDHDARDAAERQREAADRTAAYLGEA
EVRLQEVTALLASTRAEAEALAVESRDSARKVREDAVHDARAAIADAERRARETVADAER
RAREAVADAEERLDRIRIEREAVAAYLENVRGVLTQADDSASSDDDDDEPRTAR
Download sequence
Identical sequences M5B8G0
gi|473833352|ref|YP_007685650.1| WP_015490080.1.38469 WP_015490080.1.57954 WP_015490080.1.98982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]