SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015490886.1.98982 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015490886.1.98982
Domain Number 1 Region: 26-471
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.17e-89
Family Family 1 of glycosyl hydrolase 0.000000403
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015490886.1.98982
Sequence length 472
Comment beta-glycosidase [Clavibacter michiganensis]; AA=GCF_001643055.1; RF=na; TAX=31963; STAX=28447; NAME=Clavibacter michiganensis subsp. nebraskensis; strain=DOAB 395; AL=Contig; RT=Major
Sequence
MTPRDAVPDRPTPTELAGLLAGGPRIGVSTSATKVEGRAHEGGRTESVWDAFARRPGAVA
DGSDPERGARHMERYREDVALAAELGADVLSFSLSWSRIQPEARGGLRREGIAFYDELVD
ALLAAGIRPRAALHDHDLPVELQDRGGWLHRDTALRFGDLAYLAAEALADRVPDWVTLRT
PALTTMAGHVAGTHAPGSRLGLDALLTVHHQLLAHGRAVEAIRGASSAARVGIVNAHRVV
EAATGDDDDRAAAVVARALHQDLFADAVLLGRYPDLAGPHAEAFERLGRVDPADLRSIGQ
PLDHYGVALADPIRVAAVPRLVAGSTATPFAELPWTDHPASLDGHPVAPDLVPVVLADLR
ARYGDALPPVVLSGLDAAHPEQVDDRDGSRRDPRRAHAISDHLVEALAAVAPGGPAEGVR
LEAVVAGSLLDGFEWEAGRAHPRGLVHVDPLTGDRAPRSSYRFLRDTLRERG
Download sequence
Identical sequences M5BDP8
WP_015490886.1.38469 WP_015490886.1.57954 WP_015490886.1.98982 gi|473834187|ref|YP_007686485.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]