SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015491259.1.98982 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015491259.1.98982
Domain Number 1 Region: 185-456
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.49e-54
Family beta-glycanases 0.0000073
Further Details:      
 
Weak hits

Sequence:  WP_015491259.1.98982
Domain Number - Region: 43-122
Classification Level Classification E-value
Superfamily E set domains 0.0164
Family E-set domains of sugar-utilizing enzymes 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015491259.1.98982
Sequence length 461
Comment endoglucanase [Clavibacter michiganensis]; AA=GCF_001643055.1; RF=na; TAX=31963; STAX=28447; NAME=Clavibacter michiganensis subsp. nebraskensis; strain=DOAB 395; AL=Contig; RT=Major
Sequence
MPTRRRLKCAVVTAVAPAVVTATVLVAPAAGARAASAQAAPTAPAATVLSVASGPVGTPV
TVTGTGFPAKKAAVVAVGSTTKRITTTATGRFTTAITIPRTSLSTIRITATAGTRSAGAP
FTVTTAKSNGSARLGASAPAPTTTPAPAPTGAPTSTAAPAPATSSPAPAASAAPAISSAR
LRLGLSTPGGPTANGELDAASTTLGESPSIVMSHVDFTHPAPIAGLRSVAARGADSLITW
EPWQGGAGVDQPAYANARIVAGDYDSYIRSWGADLAKYGQPVYLRFGHEMNGNWYPWSDG
VNGNASGSYVQAWKHVHDLVAAQGATNVKWVWSPNVPYPGSTDLASLYPGADQVDVVALD
GYNWGAVPGQRWTAPADLFGPGMAQLRAVAPGKPLIIGEVASGETGGSKADWDRDLVAYL
QSQPDVLGFVWFDFKKEEDWRIDSSAASATALRDALALRRG
Download sequence
Identical sequences M5BBB2
WP_015491259.1.38469 WP_015491259.1.57954 WP_015491259.1.98982 gi|473834594|ref|YP_007686892.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]