SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015491267.1.38469 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015491267.1.38469
Domain Number 1 Region: 10-333
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2e-96
Family Glycosyl hydrolases family 35 catalytic domain 0.000048
Further Details:      
 
Domain Number 2 Region: 444-577
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.22e-26
Family Beta-galactosidase LacA, domains 4 and 5 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015491267.1.38469
Sequence length 596
Comment beta-galactosidase [Clavibacter michiganensis]; AA=GCF_000355695.1; RF=na; TAX=1097677; STAX=28447; NAME=Clavibacter michiganensis subsp. nebraskensis NCPPB 2581; strain=type strain: NCPPB 2581; AL=Complete Genome; RT=Major
Sequence
MPGLPATSTRFRIGADDFELDGQPHRVIAGALHYFRVHPDQWADRIRKARLMGLDTIETY
VAWNAHSPERGAFDTSAGLDLGRFLDLVHAEGMHAIVRPGPYICAEWDGGGLPGWLFEDP
AVGVRRSEPLYLAAVDEFLRRVYEIVAPRQIDHGGPVILVQIENEYGAYGDDADYLRHLV
DLTRESGIIVPLTTVDQPTDEMLSRGSLDELHRTGSFGSRATERLATLRRHQPTGPLMCS
EFWDGWFDHWGEHHHTTSAADAAAELDALLAAGASVNIYMFHGGTNFGFTNGANHKGTYQ
SHVTSYDYDAPLDETGSPTPKFFAFRDVIARYRSVPDEMPAGRGDAPAFEVAFDAVAPLA
DLVTDPAGWRATSAVPSMDALGVFRGFALHRVQLPASDQTRVLAFGEVRDRAVVSVDGVR
IGVIQRDQHETAIAVPPGRTLEVLVEDQGRVNYGVRIGEAKGLIGPATLDGAELAGWESL
PLDLGAMAASVASAAAFAAETSPVAFLDGPVLAHASFEMDAPADLFLDTRSWGKGVAFVN
GFALGRYWTRGPQHTLYVPGAQLRAGRNDLVVFETGAAADPVVAFLAQPELGHLES
Download sequence
Identical sequences M5BBD3
WP_015491267.1.38469 WP_015491267.1.57954 WP_015491267.1.98982 gi|473834602|ref|YP_007686900.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]