SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015505216.1.58722 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015505216.1.58722
Domain Number 1 Region: 15-126
Classification Level Classification E-value
Superfamily GlnB-like 6.35e-32
Family Prokaryotic signal transducing protein 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015505216.1.58722
Sequence length 129
Comment hypothetical protein [Candidatus Methanomethylophilus alvus]; AA=GCF_000300255.2; RF=na; TAX=1236689; STAX=1291540; NAME=Candidatus Methanomethylophilus alvus Mx1201; strain=Mx1201; AL=Complete Genome; RT=Major
Sequence
MADAPIARKAAAGTLKKVVIITRREMLGALKSQMDGLGISGMTISYVEGFGAQKGHTQTY
RGVHVDSALLPKMKAEIVASKIPVQDVVEAAKRAIHTGAVGDGKIFTYDVENAFRIRTGQ
SGADAVSAE
Download sequence
Identical sequences M9SED7
WP_015505216.1.58722 gi|478483343|ref|YP_007713993.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]