SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015545899.1.48748 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015545899.1.48748
Domain Number 1 Region: 169-286
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 7.85e-21
Family Peptidoglycan hydrolase LytM 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015545899.1.48748
Sequence length 288
Comment metallopeptidase [Alistipes shahii]; AA=GCF_000210575.1; RF=representative genome; TAX=717959; STAX=328814; NAME=Alistipes shahii WAL 8301; strain=WAL 8301; AL=Chromosome; RT=Major
Sequence
MKFLKTIRAWWRGLFRKRRFNMLNATDNTEEWHMHLSPASILAGLVAFMLMLFILTLSLV
AYSPILEFLPGYRTEADRSRESLVQNIIRLDSMERMMNDMLTYNENIALIMEGRTPVARV
LASSDSSRISKVLVMPSHEDSLLRAQMEGDGEYAIAGQGGSRRQVREAIELATPVEGIIT
GKFDIRQGNFGVKIAATAADRITAIDNGTVIQSLWTPETGYIVVLQHAGNLISVYKNLSQ
SLVTTGQTIRSGELIGYNAEVQDGEVRLFEFELWNNGKPVDPEGYIVF
Download sequence
Identical sequences D4IJ33
gi|479185360|ref|YP_007815706.1| WP_015545899.1.48748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]