SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015579811.1.83303 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015579811.1.83303
Domain Number 1 Region: 48-269
Classification Level Classification E-value
Superfamily Phase 1 flagellin 3.53e-32
Family Phase 1 flagellin 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015579811.1.83303
Sequence length 271
Comment flagellin protein [Streptomyces sp. PAMC 26508]; AA=GCF_000364805.1; RF=na; TAX=1265601; STAX=1265601; NAME=Streptomyces sp. PAMC 26508; strain=PAMC 26508; AL=Complete Genome; RT=Major
Sequence
MSETTPNSKGPAKVQLSPEQVAGLGLASAPGATTSDVSVAPLEKRLEVRSASAALDFIMT
TEGHLDELTSVLQRMRVLSLQSANGTYSEEDRSATQAEFDQLFGEIARIADQADLNKVRM
FDDASAEGNVRGADELGMMPAKTNTPASLASAQASWTLRVHMGANADEALTVNVLAADIQ
HLFASEGATPADQGAAAPADQQGRVAVEGPVNVLTAIDANLSLAKIDVAIRTVTAQRSNL
GAFSNRLESAIRRGEYAVENLTASDTAIERA
Download sequence
Identical sequences M9U291
gi|479323274|ref|YP_007863325.1| WP_015579811.1.83303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]