SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015585031.1.31814 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015585031.1.31814
Domain Number 1 Region: 1-59,87-147,217-312,497-563
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.11e-38
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.024
Further Details:      
 
Domain Number 2 Region: 337-503
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2.58e-30
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015585031.1.31814
Sequence length 567
Comment FAD-dependent oxidoreductase [Raoultella ornithinolytica]; AA=GCF_000367425.1; RF=na; TAX=1286170; STAX=54291; NAME=Raoultella ornithinolytica B6; strain=B6; AL=Complete Genome; RT=Major
Sequence
MSGHKKVDVLVVGSGAAGLSAAVTAALKGASVLLAEKESVIGGTSAWSGGWLWIPRNPLA
REEGIQEQEDAPLTYLQHEMGGQPADARLLTFLQQGPEMIDFFRRHTAVQFLSGSKMPDF
HMSPGYAQGGRSVTAQPFDGRLLGDWLHRLRPPLETISLAGMGIAGGSDMAHFFNATRSP
RSALYAARRLLRHGWQQLRTGRGQYLVNGNALMGRLLRSALDAGVSIQLNAPVARLLTSS
TGVSGAVLRSDDGDIEVQAGAVILACGGFPHDRQRLAQQVPHAADGYGHFSAAPPGNQGD
GIRLGESVGGQFDASLKHAMAWAPVSRVTLASGLQLVFPHLVERAKPGFIAVLPNGKRFT
NEADSYHDFIAALLAATPAGEQPTAWLLADSRTLRRYGLGHARPFPFSPAAWLRTGYLHS
APTLAALAEQCAIDGGQLAETVARFNDYAARGEDPEFQRGVSAYNRAQGDARHPHHPTLG
PLRHAPFYAVRILPGSLGSFSGLKTDEQARVLDAHQQPIAGLYAIGNDMSSVMQGYYPSG
GITLGPAMTFGYLVGKTLAANITKTAS
Download sequence
Identical sequences gi|481850453|ref|YP_007874893.1| WP_015585031.1.31814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]