SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015592507.1.96367 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015592507.1.96367
Domain Number 1 Region: 3-104
Classification Level Classification E-value
Superfamily Hypothetical protein YfhH 1.7e-45
Family Hypothetical protein YfhH 0.0000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015592507.1.96367
Sequence length 109
Comment hypothetical protein [Bacillus sp. 1NLA3E]; AA=GCF_000242895.2; RF=na; TAX=666686; STAX=666686; NAME=Bacillus sp. 1NLA3E; strain=1NLA3E; AL=Complete Genome; RT=Major
Sequence
MQQEKRYSNLNEFELRQEIATLNEKAKKAEQLGMVNEYAVLERKVVMAKAYLLNPEDFLP
GEIYEIIGDPGAYFKVDYLNGVFAWGYRLNGDGKEEALPISMLKIEARN
Download sequence
Identical sequences N0AM93
gi|488571144|ref|YP_007908943.1| WP_015592507.1.96367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]