SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015593531.1.96367 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015593531.1.96367
Domain Number 1 Region: 146-345
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.44e-59
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000522
Further Details:      
 
Domain Number 2 Region: 430-561
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.83e-32
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000667
Further Details:      
 
Domain Number 3 Region: 13-145
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.64e-30
Family Duplicated SiR/NiR-like domains 1 and 3 0.0012
Further Details:      
 
Domain Number 4 Region: 347-422
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 5.23e-22
Family Duplicated SiR/NiR-like domains 1 and 3 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015593531.1.96367
Sequence length 572
Comment sulfite reductase subunit beta [Bacillus sp. 1NLA3E]; AA=GCF_000242895.2; RF=na; TAX=666686; STAX=666686; NAME=Bacillus sp. 1NLA3E; strain=1NLA3E; AL=Complete Genome; RT=Major
Sequence
MVNTKLTAPDGPPSDVEGIKERSNFLRGTLKEVMLDRLSAGIPEDDNRLMKHHGSYLQDN
RDLRNERQKQKLEPAYQFMLRVRLPGGVATPNQWLAMDDLAQRNGNGTLKLTTRMTFQMH
GILKWNMKNTIQEIHASLMDTIAACGDVNRNVMCNPNPYQSEIHSEVYGWAKKLSDDLLP
RTRAYHEIWLDEEKVAGTPEIEDVEPMYGPLYLPRKFKIGITVPPSNDIDVFSQDLGLIA
IVENGKLIGFNVAIGGGMGMTHGDKATYPQLAKVIGFCTPEKIYDVAEKVITIQRDYGNR
SVRKNARFKYTVDRLGLETVKTELENRLGWRLDEARTFHFDHNGDRYGWVKGVQGKWHLT
LFIQGGRIADFDGYKLMTGLREIAKIHTGDFRLTGNQNLIIANVSSQKKKKINELIEKYG
LTDGMQYTALRRNSLACVALPTCGLAMAEAERYLPELLEKIEAIVDANGLRDDEITIRMT
GCPNGCARPALGEIGFIGKAPGKYNMYLGAAFDGSRLSKMYRENIGEEAILSELNVLFSR
FAKERQEGEHFGDFVIRAGIIEATTDGTNFHH
Download sequence
Identical sequences N0AU19
WP_015593531.1.96367 gi|488572172|ref|YP_007909971.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]