SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015608665.1.90088 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015608665.1.90088
Domain Number 1 Region: 144-261
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.17e-16
Family N-acetyl transferase, NAT 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015608665.1.90088
Sequence length 265
Comment GCN5-related protein N-acetyltransferase [Streptomyces fulvissimus]; AA=GCF_000385945.1; RF=na; TAX=1303692; STAX=68202; NAME=Streptomyces fulvissimus DSM 40593; strain=DSM 40593; AL=Complete Genome; RT=Major
Sequence
MTSLARHQLSPAETGPALRALCEWTPADAPAGGLHPGDVGWLLRLDDAAVHLWTDGEVPV
AVGFLDGPVLRVTATPDADHGALAADAEELLVPGNDWSDGLPVPGWVPEQEESWLVLSWT
PRPVVSRAEPVGAAMTADRVLVHREAFAGSTFTVERHRTMMRSPAAGLACETLVRTPAGE
PAAAATGWFAGEGRCGLLEPVGTHADHRGHGYGRDAVLGTCAALARRGASAVAVMTPSAN
EAAVALYRSAGFTVVRENRDWARPR
Download sequence
Identical sequences N0CQT1
gi|488609848|ref|YP_007931184.1| WP_015608665.1.90088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]