SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015608699.1.15473 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015608699.1.15473
Domain Number 1 Region: 10-179
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.09e-43
Family N-acetyl transferase, NAT 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015608699.1.15473
Sequence length 190
Comment MULTISPECIES: IucA/IucC [Streptomyces]; AA=GCF_000716935.1; RF=na; TAX=67269; STAX=67269; NAME=Streptomyces alboviridis; strain=NRRL B-1579; AL=Contig; RT=Major
Sequence
MNQPHSEETPGKPGTFTVRPLDPLADAELVHGWVTHPKAAFWLMGGAKLQDVEREYMAIA
AHPHHDAFIGLHDGEPAFLIERYDPTEVELKGLYEAEPGDVGMHFLVAPTDTPVHGFTRA
VITAVMDFLFTDPAVRRVVVEPDVTNSAVQALNKAVGFEVLREIAKPEKDALLSACTREQ
FEAATGGTDR
Download sequence
Identical sequences A0A1C6MDR9 N0CUP9
gi|488609882|ref|YP_007931218.1| WP_015608699.1.15473 WP_015608699.1.90088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]