SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015609602.1.90088 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015609602.1.90088
Domain Number 1 Region: 5-138
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.87e-22
Family N-acetyl transferase, NAT 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015609602.1.90088
Sequence length 174
Comment putative acetyltransferase [Streptomyces fulvissimus]; AA=GCF_000385945.1; RF=na; TAX=1303692; STAX=68202; NAME=Streptomyces fulvissimus DSM 40593; strain=DSM 40593; AL=Complete Genome; RT=Major
Sequence
MSAVMNLTLTDLAPDDPRMSADIAPLIRTLRPQLTAPAFAAFAEEAYGQGLRFTVAYDAT
GRVLGVATHRLLATSRGRVLFVDDLVTAPESRGRGVGAHLLAELERRARAAGCARVELDS
GTANVHAHRFYHARRMTIGALHFGLDIAPDTAPDTPPVTPPDTPPVTAPDIAPE
Download sequence
Identical sequences N0CZ24
gi|488610796|ref|YP_007932132.1| WP_015609602.1.90088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]