SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015633674.1.76749 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015633674.1.76749
Domain Number 1 Region: 4688-4864
Classification Level Classification E-value
Superfamily beta-Roll 8.11e-35
Family Serralysin-like metalloprotease, C-terminal domain 0.00035
Further Details:      
 
Domain Number 2 Region: 4393-4544
Classification Level Classification E-value
Superfamily vWA-like 2.57e-19
Family Integrin A (or I) domain 0.022
Further Details:      
 
Domain Number 3 Region: 3692-3797
Classification Level Classification E-value
Superfamily CalX-like 1.01e-17
Family CalX-beta domain 0.0034
Further Details:      
 
Weak hits

Sequence:  WP_015633674.1.76749
Domain Number - Region: 291-380
Classification Level Classification E-value
Superfamily CalX-like 0.000327
Family CalX-beta domain 0.021
Further Details:      
 
Domain Number - Region: 393-467
Classification Level Classification E-value
Superfamily CalX-like 0.00183
Family CalX-beta domain 0.022
Further Details:      
 
Domain Number - Region: 4143-4226,4377-4416
Classification Level Classification E-value
Superfamily beta-Roll 0.0408
Family Serralysin-like metalloprotease, C-terminal domain 0.011
Further Details:      
 
Domain Number - Region: 2593-2665
Classification Level Classification E-value
Superfamily CalX-like 0.0419
Family CalX-beta domain 0.022
Further Details:      
 
Domain Number - Region: 2993-3066
Classification Level Classification E-value
Superfamily CalX-like 0.0549
Family CalX-beta domain 0.022
Further Details:      
 
Domain Number - Region: 1993-2064
Classification Level Classification E-value
Superfamily CalX-like 0.0628
Family CalX-beta domain 0.022
Further Details:      
 
Domain Number - Region: 3593-3669
Classification Level Classification E-value
Superfamily CalX-like 0.0719
Family CalX-beta domain 0.021
Further Details:      
 
Domain Number - Region: 1793-1865
Classification Level Classification E-value
Superfamily CalX-like 0.0759
Family CalX-beta domain 0.022
Further Details:      
 
Domain Number - Region: 1593-1665
Classification Level Classification E-value
Superfamily CalX-like 0.0968
Family CalX-beta domain 0.022
Further Details:      
 
Domain Number - Region: 993-1065
Classification Level Classification E-value
Superfamily CalX-like 0.0994
Family CalX-beta domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015633674.1.76749
Sequence length 4919
Comment calcium-binding outer membrane-like protein [Pseudomonas protegens]; AA=GCF_001269475.1; RF=na; TAX=380021; STAX=380021; NAME=Pseudomonas protegens; strain=PGNR1; AL=Contig; RT=Major
Sequence
MSSVVAIVKSIVGQVFVVSPEGIRRVLIEGDRLFVGDEVDTGPAGAVTLELTDGRTLDLG
RDTQWSGAAPDSSTDLAQATAQAAPSVAELQQAIAAGADPTTDLEATAAGPTAAGNGGAA
GGGHSFVQLEETAGRVDPTIGFPTAGLGLANSTQDNTFGGLTNNGGLGNGNGNGSGSDSL
RPATLTLGATPTITEAGGTLVYTATLTQAPLTDLTVTLSNGAVIVISAGQTTGSVQVPLA
PQDNVYIDPGQISVSVTGTTGGGGLLVTVNPTPAVTQVTDTIDTTTVSLTADASVTEGGQ
ITYTATLTNPAQTPVTITLSNGSVITIEAGKSSGSIDVPAPANDVYKNGDTIEVGITKAE
GGNFENLQPSPDKAVTTVTDSIDDTGLSLSATDTVAEGGSIVYTATLTNPAGTPVTVTLS
NGAVITIAAGATSGTATVAAPADDVYKDAGKVEVTITKADGGNFENLVTDPAPAVTDVTD
TIDTSTVSLTATPSVAEGGTVVYTASVTAPVTGSPVVVTLSNGQTITIPVGESSASVNFT
APNDALAGGSSLSTTITKADGGNYEKLEISDKPAETSVTDTPDTTTLSVTATDTVAEGGS
IVYTATLTNAAGTPVTVTLSNGAVITIAAGATTGTTTVAAPADDVYKDAGKVEVTITKAD
GGNFENLETNPTPAVTDVTDTIDTSTVSLTATPSVAEGGTVVYTASVTAPVTGSPVVVTL
SNGQTITIPVGESSASVNFTAPNDALAGGSSLSTTITKADGGNYEKLEISDKPAETSVTD
TPDTTTLSLSATESVAEGGSIVYTATLTNAAGTPVTVTLSNGAVITIAAGATSGTATVAA
PADDVYKDAGKVEATITKSEGGNFEHLETNPAPAVTDVTDTIDTSTVSLTATPSVAEGGI
VVYTASVTAPVTGSPVVVTLSNGQTITIPVGESSGSVNFTAPNDALAGGSSLSTTITKAD
GGNYEKLEVSDKPAETSVTDTPDTTTLSLSATESVAEGGSIVYTATLTNAAGTPVTVTLS
NGAVITIAAGATSGTATVAAPADDVYKDAGKVEATITKAEGGNFENLETNPAPAVTDVTD
TIDTSTVSLTATPSVAEGGTVVYTASVTAPVTGSPMVVTLSNGQTITIPVGESSASVNFT
APNDALAGGSSLSTTITKADGGNYEKLEISDKPAETSVTDTPDTTTLSLSATESVAEGGS
IVYTATLTNAAGTPVTVTLSNGAVITIAAGATSGTATVAAPADDVYKDAGKVEATITKAE
GGNFENLETNPTPAVTDVTDTIDTSTVSLTATPNVAEGGTVVYTASVTAPVTGSPVVVTL
SNGQTITIPVGESQGSVNFTAPNDALAGGSSLSTTITKADGGNYEKLEVSDKPAETSVTD
TPDTTTLSLSATESVAEGGSIVYTATLTNAAGTPVTVTLSNGAVITIAAGATTGTTTVAA
PADDVYKDAGKVEATITKAEGGNFENLETNPAPAVTDVTDTIDTSTVSLTATPNVAEGGT
VVYTASVTAPVTGSPVVVTLSNGQTITIPVGESQGSVNFTAPNDALAGGSSLSTTITKAD
GGNYEKLEVSDKPAETSVTDTPDTTTLSLSATESVAEGGSIVYTATLTNAAGTPVTVTLS
NGAVITIAAGATSGTATVAAPADDVYKDAGKVEATITKAEGGNFENLETNPTPAVTDVTD
TIDTSTVSLTATPNVAEGGTVVYTASVTAPVTGSPVVVTLSNGQTITIPVGESSASVNFT
APNDALAGGSSLSTTITKADGGNYEKLEVSDKPAETSVTDTPDTTTLSLSATESVAEGGS
IVYTATLTNAAGTPVTVTLSNGAVITIAAGATSGTATVAAPADDVYKDAGKVEATITKAE
GGNFENLETNPAPAVTDVTDTIDTSTVSLTATPSVAEGGIVVYTASVTAPVTGSPVVVTL
SNGQIITIPVGESSASVNFTAPNDALAGGSSLSTTITKADGGNYEKLEVSDKPAETSVTD
TPDTTTLSLSATESVAEGGSIIYTATLTNAAGTPVTVTLSNGAVITIAAGATSGTATVAA
PADDVYKDAGKVEATITKAEGGNFENLETNPAPAVTDVTDTIDTSTVSLTATPSVAEGGI
VVYTASVTAPVTGSPVVVTLSNGQTITIPVGESSGSVNFTAPNDALAGGSSLSTTITKAD
GGNYEKLEVSDKPAETSVTDTPDTTTLSLSATESVAEGGSIVYTATLTNAAGTPVTVTLS
NGAVITIAAGATSGTATVAAPADDVYKDAGKVEATIAKAEGGNFENLETNPTPAVTDVTD
TIDTSTVSLTATPNVAEGGTVVYTASVTAPVTGSPVVVTLSNGQTITIPVGESSASVNFT
APNDALAGGSSLSTTITKADGGNYEKLEISDKPAETSVTDTPDTTTLSLSATESVAEGGS
IVYTATLTNAAGTPVTVTLSNGAVITIAAGATTGTTTVAAPADDVYKDAGKVEATITKAE
GGNFENLETNPAPAVTDVTDTIDTSTVSLTATPSVAEGGTVVYTASVTAPVTGSPVVVTL
SNGQTITIPVGESQGSVNFTAPNDALAGGSSLSTTITKADGGNYEKLEVSDKPAETSVTD
TPDTTTLSLSATESVAEGGSIVYTATLTNAAGTPVTVTLSNGAVITIAAGATSGTATVAA
PADDVYKDAGKVEATITKAEGGNFENLETNPAPAVTDVTDTIDTSTVSLTATPSVAEGGI
VVYTASVTAPVTGSPVVVTLSNGQTITIPVGESSASVNFTAPNDALAGGSSLSTTITKAD
GGNYEKLEISDKPAETSVTDTTDTTTLSLSATESVAEGGSIVYTATLTNAAGTPVTVTLS
NGAVITIAAGATSGTATVAAPADDVYKDAGKVEATITKAEGGNFEHLETNPTPAVTDVTD
TIDTSTVSLTATPSVAEGGTVVYTASVTAPVTGSPVVVTLSNGQTITIPVGESSASVNFT
APNDALAGGSSLSTTITKADGGNYEKLEVSDKPAETSVTDTPDTTTLSLSATESVAEGGS
IIYTATLTNAAGTPVTVTLSNGAVITIAAGATSGTATVAAPADDVYKDAGKVEATITKAE
GGNFENLETNPAPAVTDVTDTIDISTVSLTATPSVAEGGTVVYTASVTAPVTGSPVVVTL
SNGQTITIPVGESSASVNFTAPNDALAGGSSLSTTITKADGGNYEKLEVSDKPAETSVTD
TPDTTTLSLSATESVTEGGSIVYTATLTNAAGTPVTVTLSNGAVITIAAGATAGTTTVAA
PADDVYKDAGKVEATITKAEGGNFENLETNPAPAVTDVTDTIDNSTVSLKATPSAAEGGN
VTYTATVTAPVTGSPVVVTLANGEKITIPVGETTGSVSISAPNDVLVGHTPLTNSITNVS
GGNYENLIADKTPVSTTVTDTVDTTSVSLTATGTVAEGGQIIYTATLTNAAGTPVTVTLS
NGAVITIAAGATTGTTTVAAPADDVYKDAGKVEATITKAEGGNFEKLVPNTTPAVTDVTD
TIDNSTVSLKATPSAAEGGNVTYTATVTAPVTGSPVVVTLANGEKITIPVGETTGSVSIS
APNDVLVGHTPLTNSITNVSGGNYENLVADKTPVSTTVTDTVDTTSVSLTATGTVAEGGQ
ITYTATLTNAAGTPVTVTLSNGSVIHIEAGKTTGTVTVAAPADDVYIDAGKVNATITNAT
GGNFEKLVTDTTPAVTNVTDTLDTTSVGISGSASVTEGQTASYTVSLTHPAQTEVTLKIS
YSGTATDGSDFSGVYTVKIPAGASSATFNVATIDDKITEGTENFTVKIDSATGGNFENLV
VGSNNSVTTSIIDNDAPPVIDLDANNSSGATGADYKVTFTEGTTGPGVSIADTDLSITDP
DSTLLTGATIVLTNRQPGDSLNLGNSVNGITINANSKDGSITLTLSGSATLADYMQQIKN
ITFTNNSEDPSTTPRTITVTVTDGGNYSNVATTTVNVVAVNDAPTATGGAVTGNEDTPLA
LTWSNFGVSDVDSPASSLGVKITQLPSDGKLQYLDGSTWKDVANNQTFSKADIDAGKLRF
TPDANESGTNGYGGNGVGNQQADYAQIKFQPTDGQALGNTGTVTVDITPVADAPTLSVAG
NSVNSVGLLKEVWTNLSGLGTDGSGASASTLKSVIDAAGTPNSSSLATNVQSDGNITPGT
ASKTSGLIYLEAGKAYTFSGTGDDSLLVTIGGKNVASTTWGAGGNLNGTFTPTTSGYYTI
DIYHHNQSGPGSYDVNLSVNGGAAVDLSNAGVPLYTGVTDLTNAGVSVSDLHGTNGEGYY
DGYKLNEGGEGGSVHLSKITTGLTDTDGSETLSVKISGIPAGSVLSDGAGHTFTATATSG
EANVTGWNLGNLTVTPPPYYNGTFNLNVTSTSTESLGGSASTSAQIPVKVYPAVYNSVVA
TSGDDTVTGTDGNDIVVADIGGLTVVPGTNYNIAFMVDSSGSMSSASITAAKNSLTSVFN
TLKNSIGGSSSGTVNIFLADFDTQVNKSVSVNLNDPTALAQLKAVLDSMTSGGGTNYEDV
FKATANFFQSSQATGNSNATNLTYFITDGKPTYYQSGEQTNPTLYGNVRLDDVVTTSNYK
LGDTFGKYLDNSHYLSVASDGTTILQTNNGWGWSSKTLGTLHAQGDGTYELSNLAGSGSS
TDYYTTTNSNSGFALLSGLSNVEAIGINSGVSLNDLKPYDSDGKPQTNIDPNDLANSIIG
HTEATMPGADKVSGGDGNDILFGDLVSFNGVAGEGYQAMQAYVAKQTGVDVSKVTTSNVH
QYITEHYTEFDVSGSHDGNDTLLGGAGNDILFGQGGNDLLDGGKGNDILLGGTGNDTLIG
GQGNDILIGGSGADTFVWKAGDTGNDVIKDFKASEGDRIDLRDLLQGESASTIDNFLKIT
TVDGVSTLQVSSEGKLNAAGGLANADVTIKLEGNNWSNANINSLIAGSDPTIKIDHNNS
Download sequence
Identical sequences A0A2C9EE65
WP_015633674.1.27351 WP_015633674.1.76749 gi|501677613|ref|YP_007997439.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]