SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015634137.1.1721 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015634137.1.1721
Domain Number 1 Region: 25-273
Classification Level Classification E-value
Superfamily PLP-binding barrel 3.36e-62
Family Alanine racemase-like, N-terminal domain 0.0000578
Further Details:      
 
Domain Number 2 Region: 245-387
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 9.21e-32
Family Eukaryotic ODC-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015634137.1.1721
Sequence length 387
Comment MULTISPECIES: type III PLP-dependent enzyme [Pseudomonas]; AA=GCF_900109335.1; RF=na; TAX=1566226; STAX=1566226; NAME=Pseudomonas sp. NFPP18; strain=NFPP18; AL=Scaffold; RT=Major
Sequence
MSINVEDYFARETFQKMKSFADQQETPFVVIDTQMISQAYDDLRAGFEFAKVYYAVKANP
AVEIIDLLHEKGSSFDIASIYELDKVLGRGVNPANISYGNTIKKSKDIRYFYDKGVRLYA
TDSEADLRNIAKAAPGSKVYVRILTEGSTTADWPLSRKFGCQTDMAMDLLILARDLGLVP
YGVSFHVGSQQRDISVWDAAIAKVKVIFERLKEEDGIELKLINMGGGFPANYITRTNSLE
TYAEEIIRFLKEDFGDDLPEIILEPGRSLIANAGILVSEVVLVARKSRTAVERWVYTDVG
KFSGLIETMDESIKFPIWTEKKGEVEEVVIAGPTCDSADIMYENYKYGLPLNLAIGDRLY
WLSTGAYTTSYSAVEFNGFPPLKAFYV
Download sequence
Identical sequences A0A1K1XZE0 A0A2C9EGA4 A0A2K4M2T2
WP_015634137.1.101844 WP_015634137.1.11424 WP_015634137.1.1721 WP_015634137.1.21308 WP_015634137.1.23266 WP_015634137.1.27351 WP_015634137.1.38500 WP_015634137.1.39301 WP_015634137.1.41899 WP_015634137.1.42452 WP_015634137.1.462 WP_015634137.1.46426 WP_015634137.1.49818 WP_015634137.1.58641 WP_015634137.1.62026 WP_015634137.1.6225 WP_015634137.1.64508 WP_015634137.1.67749 WP_015634137.1.76749 WP_015634137.1.76969 WP_015634137.1.81001 WP_015634137.1.81277 WP_015634137.1.83211 WP_015634137.1.88821 gi|501678351|ref|YP_007998177.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]