SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015636023.1.46426 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015636023.1.46426
Domain Number 1 Region: 33-267
Classification Level Classification E-value
Superfamily PLP-binding barrel 9.59e-30
Family Alanine racemase-like, N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015636023.1.46426
Sequence length 405
Comment 2-amino-2-deoxy-D-gluconate hydrolyase (deaminating), beta-subunit [Pseudomonas protegens]; AA=GCF_001904985.1; RF=na; TAX=380021; STAX=380021; NAME=Pseudomonas protegens; strain=PA25; AL=Scaffold; RT=Major
Sequence
MSSVLNLPLVEKGAAAQGASLLQDVSLPALVLHREALEHNIRWMQKFVSDSGAELAPHGK
TSMMPALFQRQLDAGAWGITLATAVQTRAAYAHGVRRVLMANQLVGAPNMALIAELLADP
DFDFYCMVDHPDSVADLGAFFAQRGVTLKVMIEYGVVGGRCGCRTEQEVLALAKAIQAQP
ALALCGIEGYEGVIHGDQAISGIRQFADSLVRLAVDLHNDGLFAIERPIITASGSAWYDL
IAESFETHNAKGRFLSVLRPGSYVAHDHGIYKEAQCCVLDRRADLEEGLRPAMEVWAHVQ
SLPEPGFAVVALGKRDVAYDAGLPVPLRRYRAGAQASAGDDVGACKVTAVMDQHAFLTVA
PGVELRIGDIISFGTSHPCLTFDKWRTGLLVDERLQVIENLETCF
Download sequence
Identical sequences A0A2C9EP48 A0A2K4L7W8
WP_015636023.1.27351 WP_015636023.1.39301 WP_015636023.1.42452 WP_015636023.1.46426 WP_015636023.1.64508 WP_015636023.1.76749 WP_015636023.1.81001 WP_015636023.1.81277 WP_015636023.1.83211 gi|501681069|ref|YP_008000895.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]