SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015637453.1.88821 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015637453.1.88821
Domain Number 1 Region: 26-282
Classification Level Classification E-value
Superfamily PLP-binding barrel 8.14e-81
Family Alanine racemase-like, N-terminal domain 0.0000046
Further Details:      
 
Domain Number 2 Region: 254-411
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.84e-54
Family Eukaryotic ODC-like 0.0000938
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015637453.1.88821
Sequence length 415
Comment diaminopimelate decarboxylase [Pseudomonas protegens]; AA=GCF_001269495.1; RF=na; TAX=380021; STAX=380021; NAME=Pseudomonas protegens; strain=BRIP; AL=Contig; RT=Major
Sequence
MDAFNYRDGELFAEGVALSAIAERFGTPTYVYSRAHIEAQYQAYAQALSGMPHLVCFAVK
ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGQADKIVFSGVGKTRDDMRRALEVGVH
CFNVESAEELERLQLVAAELGVRAPVSLRVNPDVDAGTHPYISTGLKENKFGIDIATAED
VYIRAAQLPNLEIVGVDCHIGSQLTTLEPFIDALDRLLDLVDRLGECGIYLRHIDLGGGL
GVRYRDEEPPLAADYVKAVRERLDGRDLALVFEPGRFIVANAGVLLTRVEYLKHTEHKDF
AIVDGAMNDLIRPALYQAWMDVSAVRPRDTEPRTYDIVGPICETGDFLAKERTLALAEGD
LLAVHSAGAYGFVMSSNYNTRGRAAEVLVDGDQAVEVRRRETVAELFAGESLLPE
Download sequence
Identical sequences A0A2C9EVL8
gi|501683378|ref|YP_008003204.1| WP_015637453.1.27351 WP_015637453.1.42452 WP_015637453.1.76749 WP_015637453.1.88821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]