SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015694627.1.26313 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015694627.1.26313
Domain Number 1 Region: 422-441,498-727
Classification Level Classification E-value
Superfamily HAD-like 5.5e-49
Family Meta-cation ATPase, catalytic domain P 0.00086
Further Details:      
 
Domain Number 2 Region: 226-323
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 7.85e-21
Family Calcium ATPase, transduction domain A 0.0037
Further Details:      
 
Domain Number 3 Region: 175-227,324-414
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000000000000366
Family Calcium ATPase, transmembrane domain M 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015694627.1.26313
Sequence length 738
Comment copper-translocating P-type ATPase [Melissococcus plutonius]; AA=GCF_000283975.1; RF=na; TAX=1090974; STAX=33970; NAME=Melissococcus plutonius DAT561; strain=DAT561; AL=Complete Genome; RT=Major
Sequence
MKQQNSAMPMMNQQDNKVATKTDKHMSDTSTMQNMPMDHKNSDNNHSNQAMSDMSGMNHI
HKNMSGMDHMNMDEEMSGMSGMHMHMGNFKIRFWISVVLSIPILLFSKMMGMRLPFQFNF
TYSEWVVLFFATILFFYGGQPFFSGAKSELKQKNPAMMTLITMGISVSYVYSVYAFIVNQ
FTSGHTMNFFWELATLIDIMLLGHWIEMNAVSNASGALQKIAELLPNSAHRLNGNHQEDI
PLNEVKERDHLIVQAGEKMPADGKIIKGSTSVDESMVTGEARSVPKKEGNTIIGGSVNGS
GTIEIAVTGTGKSGYLAQVMEMVKQAQTRKSKLESLSDKVAKWLFYVALFAGIGTFIVWF
LITRNIAMTFERMVTVFVIACPHALGLAIPLVIARSTSIGARHGLLIKNRNALEQSNSIN
YVLLDKTGTLTEGKFTVVGLEILTNTYDEKEVLKYIGALEKNSNHPLAVGIMNDLNKQKI
QSYQSENQQNISGVGISGKVNGKIVKIVNEKEIERLMFTVDLATKQKYQKQGNTISYLII
EKQLVALIALGDEIKKESKRFIQELEKQKITPVMLTGDNEIAAKNVAEQLAISEYYSNLL
PEDKEKLVQKYLNEGKKVMMVGDGINDAPSLAASTIGVAIGAGTDVAIESADVVLTNSNP
IDILRFFDLAKQTRKKMIQNLWWGAGYNIVAIPLATGILAPIGIVLSPMIGALFMSLSTI
IVAINALTLKIHGEETNL
Download sequence
Identical sequences H5T3G2
WP_015694627.1.26313 gi|379727015|ref|YP_005319200.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]