SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015732524.1.10243 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015732524.1.10243
Domain Number 1 Region: 42-175
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 1.57e-37
Family MJ1460-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015732524.1.10243
Sequence length 178
Comment hypothetical protein [Methanocaldococcus vulcanius]; AA=GCF_000024625.1; RF=representative genome; TAX=579137; STAX=73913; NAME=Methanocaldococcus vulcanius M7; strain=M7; AL=Complete Genome; RT=Major
Sequence
MRVELKTKDMKEFYKIFSESEFIITDDSKLINETVNYLKKKYENNTKKKKLIPLDLFKAI
VLIMMKKIKELDSEITLYDIGYEFGKHLNPKKYSDLKKFFKENNLGTLKVDSRKPLILKV
ENCSFCEDLSFEEPICYFDAGLIAGAYECILKKPVVVDEIKCMARGDDACYFKVEVVK
Download sequence
Identical sequences C9RFF1
gi|261402561|ref|YP_003246785.1| WP_015732524.1.10243 579137.Metvu_0444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]