SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015736124.1.52352 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015736124.1.52352
Domain Number 1 Region: 1-208
Classification Level Classification E-value
Superfamily CutC-like 1.31e-57
Family CutC-like 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015736124.1.52352
Sequence length 228
Comment MULTISPECIES: copper homeostasis protein CutC [Paenibacillus]; AA=GCF_000517945.1; RF=na; TAX=1227351; STAX=1227351; NAME=Paenibacillus sp. FSL H8-457; strain=FSL H8-457; AL=Contig; RT=Major
Sequence
MLLEIIATCVDDAITAEKNGADRLELITAITEGGLTPGIGLVEEVVKAVRIPVHVMVRPH
SRSFVYNALDIATMVAEVKAIRKAGAAGVVLGMLTPEGKIDEAALAQMLEWTGDMQVTFH
RAFDELEDQFEGLRTLQKYPAVTRVLTSGGPQPAPQAIPRIRELVEQAAGTGLKILAGNG
LKWEIIRDFIDQTGVSEVHFGSAVRYGRSGLKPIDPVELRSLADSLHQ
Download sequence
Identical sequences D3E5B9
gi|261407726|ref|YP_003243967.1| 481743.GYMC10_3931 WP_015736124.1.35877 WP_015736124.1.52352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]