SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015748174.1.85990 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015748174.1.85990
Domain Number 1 Region: 213-350
Classification Level Classification E-value
Superfamily CBS-domain pair 1.77e-23
Family CBS-domain pair 0.0043
Further Details:      
 
Domain Number 2 Region: 352-413,446-473
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.00000000000171
Family CorC/HlyC domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015748174.1.85990
Sequence length 486
Comment HlyC/CorC family transporter [Nakamurella multipartita]; AA=GCF_000024365.1; RF=representative genome; TAX=479431; STAX=53461; NAME=Nakamurella multipartita DSM 44233; strain=DSM 44233; AL=Complete Genome; RT=Major
Sequence
MIAQWIMVGVGLVLIAGTALYVAAEFSLVTADRAAVAKQAAQGDRGARSLMIGLRSLSTQ
LSGAQIGITITTLALGFVMQPALADLVAPLLDAIGLGAGVSQTVGALFGLVVATVLSMVF
GELVPKNIAIAEPLDTAKTVITPMRVSTMLFKPLIIVLNGTANAVLRAIGVEPQEELRSA
RSAVELDSLVRRSAAQGTLEQPTAGLLARSISFSGKTADDVLTPRVRVRFVKATDTANAV
LTAAVETGHSRFPVFGEDSDDVVGLVHLKRAVAIPPDERAGVRVEQLMVPVPVVPGSIPL
DDLMDELRSGLQMAVVADEYGGTAGLLTLEDVVEELVGEIKDEHDPVDSRAERRADDTWL
LPGTLRPDEIVDITGVRLPESSAYETVAGLLIARLGRMPKEFDAVEVDATMDASAHLGVP
DRQVVHSDDRRIEPETEDDLPRAVTVRLTVHGLARRRIEAVLLSAVSLNTGDEDENESDE
RRGDGR
Download sequence
Identical sequences C8XAP7
gi|258653133|ref|YP_003202289.1| 479431.Namu_2962 WP_015748174.1.85990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]