SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015749710.1.85990 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015749710.1.85990
Domain Number 1 Region: 6-148
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.000000000000235
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015749710.1.85990
Sequence length 153
Comment GyrI-like domain-containing protein [Nakamurella multipartita]; AA=GCF_000024365.1; RF=representative genome; TAX=479431; STAX=53461; NAME=Nakamurella multipartita DSM 44233; strain=DSM 44233; AL=Complete Genome; RT=Major
Sequence
MTDPVTVLTVHPRSLAAVRCEVAPGEVSTAWGPAIGKVWDFIRSRPGLWTDGHNIFVYHH
PDQPGAPIVCEFGVEVTGPFPPVGDVYATATLGGEAAVAVHRGRYDRMPETYRAITEWMA
ANRRESAGHSWEIYGDPTPDPSRTETTIVHLLK
Download sequence
Identical sequences C8X6Z7
479431.Namu_4616 WP_015749710.1.85990 gi|258654728|ref|YP_003203884.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]