SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015758422.1.30109 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015758422.1.30109
Domain Number 1 Region: 1-127
Classification Level Classification E-value
Superfamily AF1862-like 1.05e-38
Family Cas Cmr5-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015758422.1.30109
Sequence length 133
Comment type III-B CRISPR module-associated protein Cmr5 [Desulfotomaculum acetoxidans]; AA=GCF_000024205.1; RF=representative genome; TAX=485916; STAX=58138; NAME=Desulfotomaculum acetoxidans DSM 771; strain=DSM 771; AL=Complete Genome; RT=Major
Sequence
MSKTLEQERAADALQKVKEVRQERKDLLIEYSSYAKSLPATILANGLGQAAATLLAKAKD
NKKDAHYILYTHLREWLCSDREVVPYNKGEDLMEAITSNDRNAYIRAQAEALAWLQWLKK
FAAAYLHNPEGEK
Download sequence
Identical sequences C8W2P6
gi|258516131|ref|YP_003192353.1| 485916.Dtox_2976 WP_015758422.1.30109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]