SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015772127.1.39474 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015772127.1.39474
Domain Number 1 Region: 13-148
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.53e-29
Family Phosphoglucomutase, first 3 domains 0.00019
Further Details:      
 
Domain Number 2 Region: 182-290
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 9.81e-29
Family Phosphoglucomutase, first 3 domains 0.00014
Further Details:      
 
Domain Number 3 Region: 310-401
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.49e-24
Family Phosphoglucomutase, first 3 domains 0.0018
Further Details:      
 
Domain Number 4 Region: 405-496
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.00000000000000436
Family Phosphoglucomutase, C-terminal domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015772127.1.39474
Sequence length 502
Comment phosphomannomutase/phosphoglucomutase [Jonesia denitrificans]; AA=GCF_000024065.1; RF=representative genome; TAX=471856; STAX=43674; NAME=Jonesia denitrificans DSM 20603; strain=DSM 20603; AL=Complete Genome; RT=Major
Sequence
MSAHKPGVDLAEIIKSYDVRGVVPQQLNAEVAQAIGAAFATVVVIPDAGDRADQTPADIV
AAGGRRPQVVVGRDMRESGPELVAAFARGLTAAGVDVLDIGLCSTDGLYHASGVWGIPGA
MFTASHNPAQYNGMKLCRAGARPVGQDSGLGRIRELAQQYVAYGLPGEATQLGQVSRREM
LGEYASFLRSLVDISGIRPLKVVVDAGNGMGGLTVPAVFGDAAGLPALPLDIVPLYFELD
GSFPNHEANPLDPKNLVDLQRAVVEHGADIGLAFDGDADRCFVVDEQGRAVSPSAITSLV
GLREVAKEREAGRDPVVIHNLITSRAVPDFLEAAGARVVRTRVGHSFIKAEMASHEAIFG
GEHSAHYYFRDFFFADTGMLAALHVLAALGSQPHPLSAIADMYEPYVASGEINSTVRDVP
AARARIVDAYVTNQGGGEVVVDELDGLTVSHWEGHPQWWFNVRASNTEPLLRLNVEAADE
DMMVKVRDDVLGLIRGTEGEQE
Download sequence
Identical sequences C7QZU1
WP_015772127.1.34072 WP_015772127.1.39474 471856.Jden_1856 gi|256833075|ref|YP_003161802.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]