SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015783206.1.62203 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015783206.1.62203
Domain Number 1 Region: 111-259
Classification Level Classification E-value
Superfamily Aspartate/glutamate racemase 1.44e-38
Family Aspartate/glutamate racemase 0.00043
Further Details:      
 
Domain Number 2 Region: 8-109
Classification Level Classification E-value
Superfamily Aspartate/glutamate racemase 3.79e-36
Family Aspartate/glutamate racemase 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015783206.1.62203
Sequence length 281
Comment glutamate racemase [Cyanothece sp. PCC 8802]; AA=GCF_000024045.1; RF=na; TAX=395962; STAX=395962; NAME=Cyanothece sp. PCC 8802; strain=PCC 8802; AL=Complete Genome; RT=Major
Sequence
MRSVQNSPIGVFDSGVGGLTVLRELYRQLPQESMLYFADTARLPYGNRSGAEILQYVREI
LVWMSQQNVKMVIMACNTSSALALDIVRSEFNFPILGVILPGARAAVKQGQRIGVISTPA
TAKSNAYRQAIQEINPKAQVWQVGCPEFVPLIEANRIHDPYTKQVAWKYLAPLLAQNIDT
LVYGCTHYRHLSPIFQEIIPPTVNLIDPANFVVAAAKKELELMGLRHNEPPRPTRFAVSG
CPQTFSQISQQWLGYYPLTEQVSLPMTINPSLVREGLEILE
Download sequence
Identical sequences gi|257058497|ref|YP_003136385.1| WP_015783206.1.62203 395962.Cyan8802_0603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]